PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.YX2BB
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family EIL
Protein Properties Length: 540aa    MW: 61633 Da    PI: 6.4189
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.YX2BBgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3427.91e-130313571336
                  XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
         EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWWkek 98 
                  eel++rmwkd+++lkrlke++k   ++++ a++++k +++++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+g+sd++raWWkek
  Araip.YX2BB  31 EELERRMWKDRIKLKRLKEKQKI--AAQQ-AAEKQKPRHTTDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGSSDNIRAWWKEK 125
                  8*****************99996..3455.599***************************************************************** PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT--.---- CS
         EIN3  99 vefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdqgtppyk 196
                  v+fd+ngpaai+ky+a++l++s+++++  ++ +++++l++lqD+tlgSLLs+lmqhcdppqr++plekg++pPWWPtG+e+ww +  l+++q+ ppyk
  Araip.YX2BB 126 VKFDKNGPAAITKYEAECLAMSEADNN--RNGNSQSTLQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGIPPPWWPTGNEDWWIQSNLPHNQS-PPYK 220
                  **********************99988..789999*************************************************999****99.9*** PP

                  -GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XX CS
         EIN3 197 kphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahssslrkqspkvtlsceqkedvegkkeskikh 294
                  kphdlkk+wkv+vLt+vikhmsp+i++ir+++rqsk+lqdkm+akes+++l vl++ee+++++ s++++  r+q ++   s+++ +++ ++k++  k 
  Araip.YX2BB 221 KPHDLKKMWKVGVLTSVIKHMSPDIAKIRRHVRQSKCLQDKMTAKESAIWLGVLSREEALIRQYSTDNEDRRNQVTDAEPSDNSRRNSIQEKDQAEKR 318
                  *******************************************************************9987888877777777665554554444232 PP

                  XXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX CS
         EIN3 295 vqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrg 336
                   +    +   +++ k+  ++ ++++ + + vs++  ++q + 
  Araip.YX2BB 319 PKR--PRLRSNTT-KKLPPQPNNETLQVEPVSTLPSENQTEA 357
                  222..21222222.2222333444444455555555555554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048732.5E-12631278No hitNo description
Gene3DG3DSA:1.10.3180.101.8E-71152286IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167683.66E-61159282IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MLNYSSDIDV DDIRCHNIAE KDVSDEEIEA EELERRMWKD RIKLKRLKEK QKIAAQQAAE  60
KQKPRHTTDQ ARRKKMSRAQ DGILKYMLKL MEVCKARGFV YGIIPEKGKP VSGSSDNIRA  120
WWKEKVKFDK NGPAAITKYE AECLAMSEAD NNRNGNSQST LQDLQDATLG SLLSSLMQHC  180
DPPQRKYPLE KGIPPPWWPT GNEDWWIQSN LPHNQSPPYK KPHDLKKMWK VGVLTSVIKH  240
MSPDIAKIRR HVRQSKCLQD KMTAKESAIW LGVLSREEAL IRQYSTDNED RRNQVTDAEP  300
SDNSRRNSIQ EKDQAEKRPK RPRLRSNTTK KLPPQPNNET LQVEPVSTLP SENQTEAQVV  360
GQIHGNERGN DTDTSMRLVD KGPEVPAQLP ATGFDHFSYL HLNNLVPSES MYMSGRQLHY  420
PEVQNPDMHQ GTSYNIYNPV AGYDPSHDGQ QLQPGNDEPM QPDNAVSMQP EHNMKGDEIT  480
GDLQYFGKDP FQSELDRPID HSFFGSPISS MSLDFGGFNS PPFHLDDFLG DDEMIQYFGA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A3e-731582839134ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016171171.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231161e-167EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLA0A0S3SG820.0A0A0S3SG82_PHAAN; Uncharacterized protein
STRINGGLYMA15G03650.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32234200
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-155ETHYLENE-INSENSITIVE3-like 3